Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183747

K(lysine) Acetyltransferase 6B (KAT6B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GTPTS, MORF, MOZ2, MYST4, ZC2HC6B, qkf, querkopf, AI507552, B130044K16Rik, MYST-4, Morf, Myst4, mKIAA0383, id:ibd5103, si:dkey-24f15.3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Dog (Canine), Mouse (Murine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183747
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MYST4 antibody: synthetic peptide directed towards the N terminal of human MYST4
Sequence MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSH GLDKKTVSEQ
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against MYST4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MYST4
Background MYST4 is a histone acetyltransferase which may be involved in both positive and negative regulation of transcription. It is required for RUNX2-dependent transcriptional activation and May be involved in cerebral cortex development.
Molecular Weight 36kDa
Gene ID 23522
NCBI Accession AAH48199, NM_001256468
UniProt Q8WYB5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MYST4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Utley, C�té: "The MYST family of histone acetyltransferases." in: Current topics in microbiology and immunology, Vol. 274, pp. 203-36, 2003 (PubMed).

Alternatives for antigen "K(lysine) Acetyltransferase 6B (KAT6B)", type "Antibodies"
Hosts (6), (5)
Reactivities (9), (2)
Applications (8), (4), (2), (1), (1), (1), (1)
Epitopes (1), (1)
Beacon