Did you know that you can buy products from over 140 different suppliers from us?

K(lysine) Acetyltransferase 6B (KAT6B) (N-Term) antibody

Details for Product No. ABIN183747
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms id:ibd5103, si:dkey-24f15.3, GTPTS, MORF, MOZ2, MYST4, ZC2HC6B, qkf, querkopf, AI507552, B130044K16Rik, MYST-4, Morf, Myst4, mKIAA0383
Epitope
N-Term
(1), (1)
Reactivity
Rat (Rattus), Dog (Canine), Mouse (Murine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(9), (2)
Host
Rabbit
(6), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (4), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183747
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MYST4
Sequence MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSH GLDKKTVSEQ
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against MYST4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MYST4
Background MYST4 is a histone acetyltransferase which may be involved in both positive and negative regulation of transcription. It is required for RUNX2-dependent transcriptional activation and May be involved in cerebral cortex development.
Molecular Weight 231 kDa
Gene ID 23522
NCBI Accession NM_001256468
UniProt Q8WYB5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 2073 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-K(lysine) Acetyltransferase 6B (KAT6B) (N-Term) antibody WB Suggested Anti-MYST4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Utley, C�té: "The MYST family of histone acetyltransferases." in: Current topics in microbiology and immunology, Vol. 274, pp. 203-36, 2003 (PubMed).

Validation Images
back to top