Hypermethylated in Cancer 2 (HIC2) antibody

Antigen: Hypermethylated in Cancer 2 (HIC2)

Synonyms: HRG22, ZBTB30, KIAA1020, AA409108, mKIAA1020, zgc:109776, HIC2, hic2, MGC154932

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN183767

Additional Information

Alternative name: HIC2 / ZBTB30

Gene ID: HIC2

UniProt: Q96JB3

Immunogen: The immunogen for anti-HIC2 antibody: synthetic peptide directed towards the N terminal of human HIC2

Sequence: MVSGPLALRWCAWAGRGDMGPDMELPSHSKQLLLQLNQQR TKGFLCDVII

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HIC2 antibody concentration is 1 mg/ml.

Description: HIon Channel2 contains 5 C2H2-type zinc fingers and 1 BTB (POZ) domain. It belongs to the krueppel C2H2-type zinc-finger protein family, Hic subfamily and is a transcriptional repressor.

Characteristics: Antigen Size: 615 amino acids

Molecular Weight: 66kDa

Application Details

Application Notes: WB Suggested Anti-HIC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HIC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Publications

Product: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).