Did you know that you can buy products from over 140 different suppliers from us?

BTB (POZ) Domain Containing 6 (BTBD6) (N-Term) antibody

Details for Product No. ABIN183840
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms btbd6, MGC145923, BDPL, btbd6a, sb:cb776, si:dkey-11b8.2, zgc:152751
Epitope
N-Term
(7), (2), (1), (1), (1)
Reactivity
Cow (Bovine), Zebrafish (Danio rerio), Human
(31), (22), (13), (13), (2), (2), (1), (1)
Host
Rabbit
(31)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(14), (13), (12), (9), (6)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183840
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human BTBD6
Sequence FVVGPPGATRTVPAHKYVLAVGSSVFYAMFYGDLAEVKSE IHIPDVEPAA
Predicted Reactivity Human : 100 %, Bovine : 80 %, Chicken : 70 %, Guinea pig : 70 %, Horse : 70 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against BTBD6. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name BTBD6
Background The function remains unknown.
Molecular Weight 46 kDa
Gene ID 90135
NCBI Accession NM_033271, NP_150374
UniProt Q96KE9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 410 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-BTB (POZ) Domain Containing 6 (BTBD6) (N-Term) antibody WB Suggested Anti-BTBD6 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
anti-BTB (POZ) Domain Containing 6 (BTBD6) (N-Term) antibody (2) anti-BTB (POZ) Domain Containing 6 (BTBD6) (N-Term) antibody (Image 2)
anti-BTB (POZ) Domain Containing 6 (BTBD6) (N-Term) antibody (3) WB Suggested Anti-BTBD6
Antibody Titration: 2.5 µg/mL
Positive Control: HepG2 cell lysate
Product cited in: Wistow, Bernstein, Wyatt et al.: "Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants." in: Molecular vision, Vol. 8, pp. 171-84, 2002 (PubMed).

Background publications Ko, Kay: "Differential interaction of molecular chaperones with procollagen I and type IV collagen in corneal endothelial cells." in: Molecular vision, Vol. 8, pp. 1-9, 2002 (PubMed).

Validation Images
back to top