Forkhead Box P4 (FOXP4) (C-Term) antibody

Details for Product No. ABIN183845
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms hFKHLA, mFKHLA, 1200010K03Rik, 2310007G05Rik, FKHLA, foxp4a, foxp4b, FOXP4, hfkhla
Epitope
C-Term
(9), (5), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(36), (12), (9), (5), (2), (2), (1)
Host
Rabbit
(32), (6), (2), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(27), (12), (9), (4), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183845
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human FOXP4
Sequence PRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASG PPEDRDLEEE
Predicted Reactivity Human : 100 %, Rabbit : 100 %, Horse : 90 %, Pig : 90 %, Mouse : 90 %, Rat : 90 %, Bovine : 80 %, Dog : 80 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against FOXP4. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name FOXP4
Background FOXP4 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Many members of the forkhead box gene family, including members of subfamily P, have roles in mammalian oncogenesis. FOXP4 may play a role in the development of tumors of the kidney and larynx.This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Many members of the forkhead box gene family, including members of subfamily P, have roles in mammalian oncogenesis. This gene may play a role in the development of tumors of the kidney and larynx. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.
Molecular Weight 72 kDa
Gene ID 116113
NCBI Accession NM_138457, NP_612466
UniProt Q8IW55
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 667 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Forkhead Box P4 (FOXP4) (C-Term) antibody WB Suggested Anti-FOXP4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Raji cell lysate
anti-Forkhead Box P4 (FOXP4) (C-Term) antibody (2) anti-Forkhead Box P4 (FOXP4) (C-Term) antibody (Image 2)
Background publications Katoh, Katoh: "Human FOX gene family (Review)." in: International journal of oncology, Vol. 25, Issue 5, pp. 1495-500, 2004 (PubMed).

Hosts (32), (6), (2), (1)
Reactivities (36), (12), (9), (5), (2), (2), (1)
Applications (27), (12), (9), (4), (2), (1), (1)
Epitopes (9), (5), (2), (2), (1), (1), (1), (1), (1)
back to top