HKR1, GLI-Kruppel Zinc Finger Family Member (HKR1) antibody

Antigen: HKR1, GLI-Kruppel Zinc Finger Family Member (HKR1)

Synonyms: BE688704, 1700025J14Rik, 4930429A13Rik, Hkr-1, HKR1, DKFZp459M128

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183873

Additional Information

Alternative name: HKR1

Gene ID: HKR1

UniProt: Q6PJD0

Immunogen: The immunogen for anti-HKR1 antibody: synthetic peptide directed towards the C terminal of human HKR1

Sequence: RECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRGFSRKSN LIRHQRTHSG

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HKR1 antibody concentration is 1 mg/ml.

Description: HKR1 is one of the GLI-Kruppel family of human genes. Members of this family have similar H-C links, i.e., a conserved stretch of 9 amino acids connecting the C-terminal histidine of one finger to the N-terminal cysteine of the next. On the basis of amino acid sequence and intron-exon organization, the genes could be placed into one of two subgroups: the GLI subgroup (with the consensus finger amino acid sequence [Y/F]XCX3GCX3[F/Y]X5LX2HX3-4H[T/S]GEKP) or the Kr subgroup (with the consensus finger amino acid sequence [Y/F]XCX2CX3FX5LX2HXRXHTGEKP).

Characteristics: Antigen Size: 659 amino acids

Molecular Weight: 75kDa

Application Details

Application Notes: WB Suggested Anti-HKR1 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-HKR1 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate

anti-HKR1, GLI-Kruppel Zinc Finger Family Member (HKR1) antibody (Image 2)

anti-HKR1, GLI-Kruppel Zinc Finger Family Member (HKR1) antibody (Image 3)

Publications

Product: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).