Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ribosomal Protein L9 (RPL9) antibody

Antigen

Ribosomal Protein L9 (RPL9)

Synonyms FLJ27456, MGC15545, NPC-A-16, DKFZp313J1510
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183899
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name RPL9
Gene ID RPL9
UniProt P32969
Immunogen The immunogen for anti-RPL9 antibody: synthetic peptide directed towards the C terminal of human RPL9
Sequence ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVS EKGTVQQADE
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-RPL9 antibody concentration is 1 mg/ml.
Description RPL9 is a ribosomal protein that is a component of the 60S subunit. RPL9 belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
Characteristics Antigen Size: 192 amino acids
Molecular Weight 21kDa

Application Details

Application Notes WB Suggested Anti-RPL9 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only

Publications

Product Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives

Alternatives for antigen "Ribosomal Protein L9 (RPL9)", type "Antibodies"
Hosts Rabbit (14), Mouse (2)
Reactivities Human (12), Mouse (Murine) (5), Rat (Rattus) (4), Cow (Bovine) (1), Dog (Canine) (1), Xenopus laevis (1), Zebrafish (1)
Applications Western Blotting (WB) (15), ELISA (10), Immunofluorescence (IF) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunohistochemistry (IHC) (1)
Epitopes C-Term (3), C-Term,AA 148-177 (1), Internal Region,AA 102-131 (1)