+1 877 302 8632
+1 888 205 9894 (Toll-free)

RPL9 antibody (Ribosomal Protein L9) (C-Term) Primary Antibody

RPL9 Reactivity: Human, Mouse, Rat, Dog WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN629974
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Binding Specificity
    • 16
    • 9
    • 9
    • 8
    • 8
    • 7
    • 7
    • 2
    • 2
    • 1
    • 1
    • 1
    Human, Mouse, Rat, Dog
    • 42
    • 34
    • 17
    • 6
    • 6
    • 4
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 55
    • 4
    • 57
    • 2
    This RPL9 antibody is un-conjugated
    • 28
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    • 54
    • 37
    • 7
    • 6
    • 3
    • 1
    • 1
    • 1
    • 1
    RPL9 antibody was raised against the C terminal of RPL9
    RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE
  • Application Notes
    WB: 1.25 µg/mL
    Optimal conditions should be determined by the investigator.

    RPL9 Blocking Peptide, catalog no. 33R-2552, is also available for use as a blocking control in assays to test for specificity of this RPL9 antibody

    For Research Use only
  • Format
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL9 antibody in PBS
    Lot specific
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Alternative Name
    RPL9 (RPL9 Antibody Abstract)
    CG6141, Dmel\\CG6141, L9, M(2)32D, Rp L9, Rpl9, anon-EST:fe3A6, anon-WO0153538.25, anon-WO0153538.26, anon-WO0153538.27, rpL9, ab02c03, fa93a01, mg:ab02c03, wu:fa93a01, zgc:103730, NPC-A-16, Ribosomal protein L9, 60S ribosomal protein L9, ribosomal protein L9, ribosomal protein L9 L homeolog, RpL9, rpl-9, rpl9, rpl9.L, RPL9, Rpl9
    RPL9 is a ribosomal protein that is a component of the 60S subunit. RPL9 belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
    Molecular Weight
    21 kDa (MW of target protein)
You are here:
help Support