Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70) antibody

Antigen: Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70)

Synonyms: RPU1, U1AP, U170K, U1RNP, RNPU1Z, SNRP70, U1-70K, snrp70, MGC130688, SNRNP70, rpu1, u1ap, u170k, u1rnp, rnpu1z, MGC89496, MGC138058

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Xenopus laevis

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183913

Additional Information

Alternative name: SNRNP70

Gene ID: SNRP70

UniProt: P08621

Immunogen: The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the N terminal of human SNRP70

Sequence: PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIK RIHMVYSKRS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SNRP70 antibody concentration is 1 mg/ml.

Description: SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Characteristics: Antigen Size: 437 amino acids

Molecular Weight: 48kDa

Application Details

Application Notes: WB Suggested Anti-SNRP70 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SNRP70 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

anti-Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70) antibody (Image 2)

Publications

Zhang, Walker, Tamplin et al.: "Zfp206 regulates ES cell gene expression and differentiation." in: Nucleic acids research, Vol. 34, Issue 17, pp. 4780-90, 2006 (PubMed).

Product: Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).