Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA) antibody

Antigen

Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA)

Synonyms RAX, PACT, DYT16, HSD14, PRKRA, MGC137944, prkra, rbpa, MGC53736
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN183963
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name PRKRA / PACT
Gene ID PRKRA
UniProt O75569
Immunogen The immunogen for anti-PRKRA antibody: synthetic peptide directed towards the middle region of human PRKRA
Sequence RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQA KRNAAEKFLA
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PRKRA antibody concentration is 1 mg/ml.
Description PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).
Characteristics Antigen Size: 313 amino acids
Molecular Weight 34kDa

Application Details

Application Notes WB Suggested Anti-PRKRA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Lee, Hur, Park et al.: "The role of PACT in the RNA silencing pathway." in: The EMBO journal, Vol. 25, Issue 3, pp. 522-32, 2006 (PubMed).

Alternatives

Alternatives for antigen "Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA)", type "Antibodies"
Hosts Rabbit (25), Mouse (5)
Reactivities Human (26), Mouse (Murine) (5), Rat (Rattus) (4), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (23), ELISA (18), Immunohistochemistry (IHC) (9), Immunofluorescence (IF) (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Dot Blot (Dot) (2), Immunoprecipitation (IP) (2), Dot Blot (DB) (1), Flow Cytometry (FACS) (1)
Epitopes pSer246 (3), Internal Region (2), N-Term (2), Ser18 (2), Ser246 (2)