Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184018

Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CFIM25, CPSF5, 25kDa, Cpsf5, AU014860, AW549947, 3110048P04Rik, 5730530J16Rik, cpsf5, zgc:63966, An16g01870, AO090003001316, Afu5g02030
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human, Zebrafish (Danio rerio), Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184018
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NUDT21 antibody: synthetic peptide directed towards the N terminal of human NUDT21
Sequence TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTK EPLYEKDSSV
Predicted Reactivity Chicken : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against NUDT21. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name NUDT21
Background NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.
Molecular Weight 25kDa
Gene ID 11051
NCBI Accession NP_008937, NM_007006
UniProt O43809
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NUDT21 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dettwiler, Aringhieri, Cardinale et al.: "Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization." in: The Journal of biological chemistry, Vol. 279, Issue 34, pp. 35788-97, 2004 (PubMed).

Alternatives for antigen "Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21)", type "Antibodies"
Hosts (12), (7)
Reactivities (18), (3), (3)
Applications (15), (13), (6), (5), (4), (3), (3), (3), (2), (1)
Epitopes (5), (1), (1)
Beacon