Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21) (N-Term) antibody

Details for Product No. ABIN184018
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CFIM25, CPSF5, 25kDa, Cpsf5, AU014860, AW549947, 3110048P04Rik, 5730530J16Rik, cpsf5, zgc:63966, An16g01870, AO090003001316, Afu5g02030
Epitope
N-Term
(5), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human, Zebrafish (Danio rerio), Chicken
(18), (3), (3)
Host
Rabbit
(12), (7)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(16), (11), (7), (6), (4), (3), (3), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN184018
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NUDT21
Sequence TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTK EPLYEKDSSV
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against NUDT21. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name NUDT21
Background NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.
Molecular Weight 25 kDa
Gene ID 11051
NCBI Accession NM_007006, NP_008937
UniProt O43809
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 227 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21) (N-Term) antibody WB Suggested Anti-NUDT21 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21) (N-Term) antibody (2) anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21) (N-Term) antibody (Image 2)
Background publications Dettwiler, Aringhieri, Cardinale et al.: "Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization." in: The Journal of biological chemistry, Vol. 279, Issue 34, pp. 35788-97, 2004 (PubMed).

Hosts (12), (7)
Reactivities (18), (3), (3)
Applications (16), (11), (7), (6), (4), (3), (3), (3), (2), (1)
Epitopes (5), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top