Adenosine Deaminase, tRNA-Specific 1 (ADAT1) antibody

Antigen: Adenosine Deaminase, tRNA-Specific 1 (ADAT1)

Synonyms: HADAT1, mADAT1, MMADAT1, ADAT1, MGC142609, adat1, MGC162299, zgc:162299

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Chicken

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN184025

Additional Information

Alternative name: ADAT1

Gene ID: ADAT1

UniProt: Q9NVB7

Immunogen: The immunogen for anti-ADAT1 antibody: synthetic peptide directed towards the C terminal of human ADAT1

Sequence: RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQA RSQISKVELF

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ADAT1 antibody concentration is 1 mg/ml.

Description: ADAT1 is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, the family participates in the pre-mRNA editing of nuclear transcripts. ADAT1, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.

Characteristics: Antigen Size: 353 amino acids

Molecular Weight: 39kDa

Application Details

Application Notes: WB Suggested Anti-ADAT1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-ADAT1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

anti-Adenosine Deaminase, tRNA-Specific 1 (ADAT1) antibody (Image 2)

Publications

Product: Venter, Adams, Myers et al.: "The sequence of the human genome." in: Science (New York, N.Y.), Vol. 291, Issue 5507, pp. 1304-51, 2001 (PubMed).