Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184029

Obg-Like ATPase 1 (OLA1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
DOC45, GBP45, GTBP9, GTPBP9, PTD004, RGD1307982, 2510025G09Rik, 2810405J23Rik, 2810409H07Rik, Gtpbp9, fe36h01, zgc:55768, zgc:85691, wu:fc66b09, wu:fe36h01, wu:fk82a02, MGC54033, MGC79585, DKFZp469M10 ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN184029
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the N terminal of human GTPBP9
Sequence GLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPD ERFDFLCQYH
Predicted Reactivity Rat :100%,   Machiloides banksi :100%,   Nicoletia meinerti :100%,   jumping bristletail :100%,   Skogsbergia lerneri :100%,   Stenochrus portoricensis :100%,   Bovine :100%,   Silk moth :100%,   Green puffer :100%,   Sumatran orangutan :100%,   Human :100%,   Lynceus sp. 'Lyn' :100%,   Asia giant forest scorpion :100%,   Euperipatoides rowelli :100%,   Giant whipscorpion :100%,   Speleonectes tulumensis :100%,   Codling moth :100%,   Prodoxus quinquepunctellus :100%,   Mouse :100%,   Acanthocyclops vernalis :100%,   Acorn barnacle :100%,   Four-lined silverfish :100%,   Dinothrombium pandorae :100%,   Eurytemora affinis :100%,   Plathemis lydia :92%,   Loxothylacus texanus :92%,   Mayfly :92%,   Neogonodactylus oerstedii :92%,   Limnadia lenticularis :92%,   Portly spider crab :92%,   Lepas anserifera :92%,   Eastern forktail :92%,   Giant desert hairy scorpion :92%,   Endeis laevis :92%,   Eremocosta gigasella :92%,   Peripatus sp. 'Pep' :92%,   Polyzonium germanicum :92%,   Florida whipspider :92%,   African malaria mosquito :92%,   Western clawed frog :92%,  
Characteristics This is a rabbit polyclonal antibody against GTPBP9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name GTPBP9
Background GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.
Molecular Weight 44kDa
Gene ID 29789
NCBI Accession NP_037473, NM_013341
UniProt Q9NTK5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GTPBP9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wiemann, Weil, Wellenreuther et al.: "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." in: Genome research, Vol. 11, Issue 3, pp. 422-35, 2001 (PubMed).

Alternatives for antigen "Obg-Like ATPase 1 (OLA1)", type "Antibodies"
Hosts (32)
Reactivities (28), (18), (18), (15), (14), (3), (2), (2), (1), (1)
Applications (23), (10), (8), (7), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (2), (2), (1)
Beacon