Exosome Component 2 (EXOSC2) antibody

Antigen: Exosome Component 2 (EXOSC2)

Synonyms: p7, RRP4, Rrp4p, hRrp4p, Rrp4, MGC30456, MGC82596, EXOSC2, fa97b01, wu:fa97b01, zgc:110117, exosc2, MGC97533, MGC137660

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN184031

Additional Information

Alternative name: RRP4 / EXOSC2

Gene ID: EXOSC2

UniProt: Q13868

Immunogen: The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the N terminal of human EXOSC2

Sequence: RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEE KLIASVAGSV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-EXOSC2 antibody concentration is 1 mg/ml.

Description: EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.

Characteristics: Antigen Size: 293 amino acids

Molecular Weight: 32kDa

Application Details

Application Notes: WB Suggested Anti-EXOSC2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-EXOSC2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).