Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Nuclear Import 7 Homolog (S. Cerevisiae) (NIP7) antibody

Antigen

Nuclear Import 7 Homolog (S. Cerevisiae) (NIP7)

Synonyms KD93, CGI-37, HSPC031, FLJ10296, Nip7p, pEachy, MGC83122, nip7, MGC110384, zgc:110384, Nip7, ACYPI003208, NIP7, DKFZp468F182
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Pig (Porcine), Chicken, Zebrafish

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN184037
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name NIP7
Gene ID NIP7
UniProt Q9Y221
Immunogen The immunogen for anti-NIP7 antibody: synthetic peptide directed towards the middle region of human NIP7
Sequence PGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIP LGFGVAAKST
Cross-Reactivity Cow (Bovine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-NIP7 antibody concentration is 1 mg/ml.
Description NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.
Characteristics Antigen Size: 180 amino acids
Molecular Weight 20kDa

Application Details

Application Notes WB Suggested Anti-NIP7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: SW620 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives

Alternatives for antigen "Nuclear Import 7 Homolog (S. Cerevisiae) (NIP7)", type "Antibodies"
Hosts Rabbit (11), Mouse (2)
Reactivities Human (11), Mouse (Murine) (4), Rat (Rattus) (4), Cow (Bovine) (2), Dog (Canine) (2), Cat (Feline) (1), Chicken (1), Pig (Porcine) (1), Xenopus laevis (1), Zebrafish (1)
Applications Western Blotting (WB) (12), ELISA (6), Immunohistochemistry (IHC) (4), Dot Blot (Dot) (1), Flow Cytometry (FACS) (1), Immunofluorescence (IF) (1), Immunoprecipitation (IP) (1)
Epitopes C-Term (2), Internal Region (1)