Did you know that you can buy products from over 140 different suppliers from us?

Nuclear Import 7 Homolog (S. Cerevisiae) (NIP7) (C-Term) antibody

Details for Product No. ABIN184038
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSPC031, KD93, Nip7p, CGI-37, pEachy, zgc:110384, 1110017C15Rik, 6330509M23Rik, AA408773, AA410017, PEachy, nip7, Nip7, ACYPI003208, NIP7, DKFZp468F182
Epitope
C-Term
(10), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Xenopus laevis, Zebrafish (Danio rerio), Human
(22), (4), (4), (1), (1), (1), (1), (1)
Host
Rabbit
(19), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(22), (9), (3), (2), (2), (2), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN184038
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human NIP7
Sequence VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIG EYVRHEETLT
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Guinea pig : 90 %, Rat : 90 %, African clawed frog : 70 %, Chicken : 70 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against NIP7. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name NIP7
Background NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.
Molecular Weight 20 kDa
Gene ID 51388
NCBI Accession NM_016101, NP_057185
UniProt Q9Y221
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 180 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nuclear Import 7 Homolog (S. Cerevisiae) (NIP7) (C-Term) antibody WB Suggested Anti-NIP7 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
anti-Nuclear Import 7 Homolog (S. Cerevisiae) (NIP7) (C-Term) antibody (2) anti-Nuclear Import 7 Homolog (S. Cerevisiae) (NIP7) (C-Term) antibody (Image 2)
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184038
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top