Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184038

Nuclear Import 7 Homolog (S. Cerevisiae) (NIP7) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSPC031, KD93, Nip7p, CGI-37, pEachy, zgc:110384, 1110017C15Rik, 6330509M23Rik, AA408773, AA410017, PEachy, nip7, Nip7, ACYPI003208, NIP7, DKFZp468F182
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184038
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NIP7 antibody: synthetic peptide directed towards the C terminal of human NIP7
Sequence VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIG EYVRHEETLT
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Guinea pig : 92%, Rat : 92%, African clawed frog : 78%, Chicken : 78%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against NIP7. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name NIP7
Background NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.
Molecular Weight 20kDa
Gene ID 51388
NCBI Accession NP_057185, NM_016101
UniProt Q9Y221
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NIP7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Nuclear Import 7 Homolog (S. Cerevisiae) (NIP7)", type "Antibodies"
Hosts (11), (4)
Reactivities (13), (3), (3), (1), (1), (1), (1), (1)
Applications (13), (3), (3), (2), (2), (1)
Epitopes (5), (2), (1), (1), (1), (1)
Beacon