La Ribonucleoprotein Domain Family, Member 7 (LARP7) antibody

Antigen: La Ribonucleoprotein Domain Family, Member 7 (LARP7)

Synonyms: PIP7S, HDCMA18P, MGC104360, DKFZp564K112, LARP7, D3Wsu161e, C330027G06Rik, fa10g04, zgc:56476, wu:fa10g04, MGC151878

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN184041

Additional Information

Alternative name: LARP7

Gene ID: LARP7

Immunogen: The immunogen for anti-LARP7 antibody: synthetic peptide directed towards the C terminal of human LARP7

Sequence: HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEK LITKAEKIRL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-LARP7 antibody concentration is 1 mg/ml.

Description: The function remains unknown.

Characteristics: Antigen Size: 355 amino acids

Molecular Weight: 39kDa

Application Details

Application Notes: WB Suggested Anti-LARP7 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-LARP7 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).