Exosome Component 4 (EXOSC4) (N-Term) antibody

Details for Product No. ABIN184050
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RRP41, RRP41A, Rrp41p, SKI6, Ski6p, hRrp41p, p12A, Rrp41, 1110039I09Rik, 1500001N04Rik, zgc:73175, EXOSC4
Epitope
N-Term
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(8), (2), (2)
Host
Rabbit
(6), (3)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(8), (5), (4), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN184050
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human EXOSC4
Sequence SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTK ALAVVYGPHE
Predicted Reactivity African clawed frog : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against EXOSC4. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name EXOSC4
Background EXOSC4 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity.
Molecular Weight 27 kDa
Gene ID 54512
NCBI Accession NM_019037, NP_061910
UniProt Q9NPD3
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 245 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Exosome Component 4 (EXOSC4) (N-Term) antibody WB Suggested Anti-EXOSC4 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
anti-Exosome Component 4 (EXOSC4) (N-Term) antibody (2) anti-Exosome Component 4 (EXOSC4) (N-Term) antibody (Image 2)
anti-Exosome Component 4 (EXOSC4) (N-Term) antibody (3) anti-Exosome Component 4 (EXOSC4) (N-Term) antibody (Image 3)
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Hosts (6), (3)
Reactivities (8), (2), (2)
Applications (8), (5), (4), (2), (1)
Epitopes (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top