Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184050

Exosome Component 4 (EXOSC4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RRP41, RRP41A, Rrp41p, SKI6, Ski6p, hRrp41p, p12A, Rrp41, 1110039I09Rik, 1500001N04Rik, zgc:73175, EXOSC4
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184050
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EXOSC4 antibody: synthetic peptide directed towards the N terminal of human EXOSC4
Sequence SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTK ALAVVYGPHE
Predicted Reactivity African clawed frog : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against EXOSC4. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name EXOSC4
Background EXOSC4 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity.
Molecular Weight 27kDa
Gene ID 54512
NCBI Accession NP_061910, NM_019037
UniProt Q9NPD3
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EXOSC4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Exosome Component 4 (EXOSC4)", type "Antibodies"
Hosts (8), (3)
Reactivities (10), (2), (2)
Applications (10), (5), (4), (2), (1)
Epitopes (2), (2), (1), (1), (1), (1), (1)
Beacon