THO Complex 3 (THOC3) antibody

Antigen: THO Complex 3 (THOC3)

Synonyms: TEX1, MGC5469, AL033344, 2410044K02Rik, THOC3, zgc:100815, MGC137361

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Zebrafish

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN184069

Additional Information

Alternative name: THOC3

Gene ID: THOC3

UniProt: Q96J01

Immunogen: The immunogen for anti-THOC3 antibody: synthetic peptide directed towards the middle region of human THOC3

Sequence: PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISW NNDNNMFFLT

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-THOC3 antibody concentration is 1 mg/ml.

Description: THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.TEX1 is part of the TREX (transcription/export) complex, which includes THO2 (MIM 300395), HPR1 (MIM 606930), ALY (MIM 604171), and UAP56 (MIM 606390).[supplied by OMIM].

Characteristics: Antigen Size: 351 amino acids

Molecular Weight: 39kDa

Application Details

Application Notes: WB Suggested Anti-THOC3 Antibody Titration: 0.25ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-THOC3 Antibody Titration: 0.25ug/ml
Positive Control: HepG2 cell lysate

anti-THO Complex 3 (THOC3) antibody (Image 2)

anti-THO Complex 3 (THOC3) antibody (Image 3)

Publications

Product: Strässer, Masuda, Mason et al.: "TREX is a conserved complex coupling transcription with messenger RNA export." in: Nature, Vol. 417, Issue 6886, pp. 304-8, 2002 (PubMed).