Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Cyclin-Dependent Kinase 1 (CDK1) antibody

Antigen

Cyclin-Dependent Kinase 1 (CDK1)
Synonyms CDK1, CDC28A, MGC111195, DKFZp686L20222, Cdc2, Cdc2a, p34, cdc2, MGC92032, zgc:92032, wu:fc30e01, CDC2, MGC134454, cdc-2, xcdc2, cdc2-a, cdc28a, p34cdc2, MGC53829
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN184166
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Cyclin-Dependent Kinase 1 (CDK1) antibody

anti-Cyclin-Dependent Kinase 1 (CDK1) antibody (2)

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name CDK1 / CDC2
Gene ID CDC2
UniProt P06493
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2
Sequence SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYF NDLDNQIKKM
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CDC2 antibody concentration is 1 mg/ml.
Description The protein encoded by CDC2 is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.
Characteristics Antigen Size: 297 amino acids
Molecular Weight 34kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-CDC2 Antibody Titration: 0.1ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cell Cycle
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Krämer, Mailand, Lukas et al.: "Centrosome-associated Chk1 prevents premature activation of cyclin-B-Cdk1 kinase." in: Nature cell biology, Vol. 6, Issue 9, pp. 884-91, 2004 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Cyclin-Dependent Kinase 1 (CDK1)", type "Antibodies"
Hosts Rabbit (144), Mouse (54)
Reactivities Human (179), Mouse (Murine) (94), Rat (Rattus) (86), Cow (Bovine) (24), Dog (Canine) (19), Horse (Equine) (18), Xenopus laevis (15), Monkey (8), Chicken (3), Primate (3), Rabbit (3), Fruit Fly (Drosophila melanogaster) (2), Zebrafish (Danio rerio) (2), Amphibian (1), Arabidopsis (1), Bird (Avian) (1), Mammalian (1), Pig (Porcine) (1), Zebrafish (1)
Applications Western Blotting (WB) (154), ELISA (78), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (76), Immunofluorescence (IF) (59), Immunoprecipitation (IP) (41), Immunohistochemistry (IHC) (29), Immunocytochemistry (ICC) (15), Functional Studies (Func) (10), Immunohistochemistry (Fixed) (IHC (fx)) (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (6), Immunohistochemistry (Frozen Sections) (IHC (fro)) (6), Flow Cytometry (FACS) (3), Dot Blot (Dot) (2), Immunoelectron Microscopy (IEM) (2), Dot Blot (DB) (1), Radioimmunoassay (RIA) (1)
Conjugates Biotin (7), Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy5.5 (2), PE,Cy7 (2)
Epitopes C-Term (19), Internal Region (5), pThr161 (4), Thr14 (3), Tyr15 (3), pThr14 (3), pThr161,Internal Region (3), pTyr15 (3), N-Term (2), pSer39 (2), AA 263-287 (1), Center (1), Center,Lys200 (1), Thr161 (1), Tyr19 (1), pSer, pThr (1), pThr14, pTyr15 (1), pTyr14 (1)