Cyclin A2 (CCNA2) antibody

Antigen: Cyclin A2 (CCNA2)

Synonyms: CCN1, CCNA, Ccn1, Ccna, Cyca, Ccn-1, AA408589, MGC156527, CycA2, cb671, chunp6924, wu:fi36f03, MGC139704, CYCA, LOC397933, ccna2, Cyclin-A2, ccn1, ccna, ccna1, MGC89518, CCNA2, MGC130969

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Chicken, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN184172

Additional Information

Alternative name: Cyclin A2

Gene ID: CCNA2

UniProt: P20248

Immunogen: The immunogen for anti-CCNA2 antibody: synthetic peptide directed towards the C terminal of human CCNA2

Sequence: YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGV SLLNPPETLNL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-CCNA2 antibody concentration is 1 mg/ml.

Description: Cyclin A is essential for the control of the cell cycle at the G1/S (start) and the G2/M (mitosis) transitions.

Characteristics: Antigen Size: 432 amino acids

Molecular Weight: 49kDa

Application Details

Application Notes: WB Suggested Anti-CCNA2 Antibody Titration: 1ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cell Cycle

Restrictions: For Research Use only

Images

WB Suggested Anti-CCNA2 Antibody Titration: 1ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Wang, Chenivesse, Henglein et al.: "Hepatitis B virus integration in a cyclin A gene in a hepatocellular carcinoma." in: Nature, Vol. 343, Issue 6258, pp. 555-7, 1990 (PubMed).