Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Matrix Metalloproteinase 2 (MMP2) antibody

Antigen

Matrix Metalloproteinase 2 (MMP2)
Synonyms
CLG4, MONA, CLG4A, TBE-1, MMP-II, GelA, Clg4a, MMP-2, 2-MMP, Dm2-MMP, MMP2, anon-WO0118547.84, dm-2MMP, l(2)02353, DmelCG1794, CG1794, fa99h12, fk89d01, wu:fa99h12, wu:fk89d01, mmp-2, fgmmp-2, Mmp-2,  ... show more
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Rabbit
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN184263
Quantity 0.1 mg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Matrix Metalloproteinase 2 (MMP2) antibody

anti-Matrix Metalloproteinase 2 (MMP2) antibody (2)

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name MMP-2
Gene ID MMP2
UniProt P08253
Immunogen The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2
Sequence AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSV KFGSIKSDWL
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rabbit, Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-MMP2 antibody concentration is 1 mg/ml.
Description MMP-2 is involved in the cleavage of gelatin type I and collagen types IV, V, VII, X.
Characteristics Antigen Size: 660 amino acids
Molecular Weight 74kDa
Synonyms CLG4, MONA, CLG4A, TBE-1, MMP-II, GelA, Clg4a, MMP-2, 2-MMP, Dm2-MMP, MMP2, anon-WO0118547.84, dm-2MMP, l(2)02353, DmelCG1794, CG1794, fa99h12, fk89d01, wu:fa99h12, wu:fk89d01, mmp-2, fgmmp-2, Mmp-2, LOC100135793

Application Details
Publications Images Alternatives back to top

Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Extracellular Matrix
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Collier, Wilhelm, Eisen et al.: "H-ras oncogene-transformed human bronchial epithelial cells (TBE-1) secrete a single metalloprotease capable of degrading basement membrane collagen." in: The Journal of biological chemistry, Vol. 263, Issue 14, pp. 6579-87, 1988 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Matrix Metalloproteinase 2 (MMP2)", type "Antibodies"
Hosts Rabbit (114), Mouse (62), Sheep (3), Goat (2), Chicken (1)
Reactivities Human (170), Rat (Rattus) (82), Mouse (Murine) (72), Cow (Bovine) (58), Pig (Porcine) (54), Sheep (Ovine) (54), Horse (Equine) (36), Chicken (20), Dog (Canine) (19), Cat (Feline) (1), Marmoset (1)
Applications Western Blotting (WB) (112), Immunofluorescence (IF) (64), ELISA (52), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (48), Immunoprecipitation (IP) (34), Immunohistochemistry (IHC) (24), Immunohistochemistry (Frozen Sections) (IHC (fro)) (11), Immunohistochemistry (Fixed) (IHC (fx)) (10), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (9), Immunocytochemistry (ICC) (5), Immunoelectron Microscopy (IEM) (3), Flow Cytometry (FACS) (2), Functional Studies (Func) (2), Dot Blot (DB) (1)
Conjugates Biotin (13), HRP (6), Alexa Fluor 350 (3), Alexa Fluor 488 (3), Alexa Fluor 555 (3), Alexa Fluor 647 (3), Cy3 (3), Cy5 (3), Cy5.5 (3), Cy7 (3), FITC (3), Gold (3), PE (3), PE,Cy3 (3), PE,Cy5 (3), PE,Cy5.5 (3), PE,Cy7 (3)
Epitopes C-Term (5), N-Term (5), AA 468-483 (2), AA 242-396 (1), AA 35-117 (1), AA 642-656 (1), AA 87-102 (1), Catalytic Domain (1), Center (1), Hinge Region (1)