Nanog Homeobox (NANOG) (N-Term) antibody

Details for Product No. ABIN184267
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ENK, ecat4, 2410002E02Rik
Epitope
N-Term
(14), (9), (9), (6), (6), (6), (4), (4), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Human
(126), (42), (20), (16), (2), (1)
Host
Rabbit
(98), (36), (12), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(6), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(122), (69), (35), (30), (21), (15), (15), (10), (6), (5), (1)
Pubmed 1 reference available
Catalog no. ABIN184267
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NANOG
Sequence PMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQ DSPDSSTSPK
Cross-Reactivity Human
Predicted Reactivity Human : 100 %, Pig : 90 %
Characteristics Antigen Size: 305 amino acids
Purification Protein A purified
Alternative Name NANOG
Background NANOG is a new marker for testicular carcinoma in situ and germ cell tumors. Gene knockdown of Nanog promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal.
Molecular Weight 35 kDa
NCBI Accession NM_024865, NP_079141
UniProt Q6JZS5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 305 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-Nanog Homeobox (NANOG) (N-Term) antibody anti-Nanog Homeobox (NANOG) (N-Term) antibody
Background publications Piestun, Kochupurakkal, Jacob-Hirsch et al.: "Nanog transforms NIH3T3 cells and targets cell-type restricted genes." in: Biochemical and biophysical research communications, Vol. 343, Issue 1, pp. 279-85, 2006 (PubMed).

Hosts (98), (36), (12), (3)
Reactivities (126), (42), (20), (16), (2), (1)
Applications (122), (69), (35), (30), (21), (15), (15), (10), (6), (5), (1)
Conjugates (6), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (14), (9), (9), (6), (6), (6), (4), (4), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
back to top