Glial Cells Missing Homolog 1 (Drosophila) (GCM1) (C-Term) antibody

Details for Product No. ABIN184316
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GCMA, hGCMa, GCMa, glide, Gcm-rs2, Gcm1-rs1, Gcma, GCM1, GCM, GCM-1
Epitope
C-Term
(6), (4), (1), (1), (1), (1)
Reactivity
Dog (Canine), Human
(27), (17), (13), (13), (12), (12)
Host
Rabbit
(20), (11)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (11), (10), (9), (4), (2)
Pubmed 1 reference available
Catalog no. ABIN184316
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human GCM1
Sequence DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKW DFEEEMTYLG
Cross-Reactivity Dog (Canine), Human
Predicted Reactivity Human : 100 %, Horse : 90 %, Dog : 90 %, Rabbit : 80 %
Characteristics Antigen Size: 436 amino acids
Purification Affinity Purified
Alternative Name GCM1 / GCMA
Background GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins.
Molecular Weight 49 kDa
NCBI Accession NM_003643, NP_003634
UniProt Q9NP62
Research Area Reproduction, Chromatin Binding Proteins, Transcription Factors
Application Notes WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 µg/mL
Positive Control: HepG2 cell lysate.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 436 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-Glial Cells Missing Homolog 1 (Drosophila) (GCM1) (C-Term) antibody WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Chuang, Chang, Chang et al.: "Histone deacetylase 3 binds to and regulates the GCMa transcription factor." in: Nucleic acids research, Vol. 34, Issue 5, pp. 1459-69, 2006 (PubMed).

Hosts (20), (11)
Reactivities (27), (17), (13), (13), (12), (12)
Applications (21), (11), (10), (9), (4), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top