Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Defensin, beta 1 (DEFB1) (AA 1-36) antibody

Antigen

Defensin, beta 1 (DEFB1)
Synonyms BD1, HBD1, DEFB-1, DEFB101, MGC51822, mBD-1, AW260221, DEFB1, MGC140110, GAL3, GAL1, DEFB1-like, RHBD-1, Defb1, CBD1
Epitope
Alternatives

AA 1-36
Clonality Monoclonal (M11-14b-H4)
Host
Alternatives

Mouse
Reactivity
Alternatives

Human
Application
Alternatives Enzyme Immunoassay (EIA), Western Blotting (WB)
Catalog no. ABIN192004
Quantity 10 µg  (Variants)
Price 245.00 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 7 to 10 Business Days

Additional Information
Application Details Alternatives Secondary Antibodies Variants back to top

Characteristics Synonyms: Beta-defensin 1, BD1, BD-1, HBD1, hBD-1, DEFB1, DEFB101
Alternative name Defensin beta 1
Swiss-Prot P60022
Immunogen Synthetic human β-Defensin 1 (aa 1-36) (3 disulfide bridges)AA Sequence: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Cross-Reactivity Human
Isotype IgG1  (Matching secondary antibodies)
Clone M11-14b-H4
Description Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodesdefensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelialsurfaces to microbial colonization. This gene maps in close proximity to defensin familymember, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. The mature form of Beta defensin 1 is 36 amino acids.
Specificity This antibody detects beta-Defensin 1 (aa 1-36). Species: Human. Others not tested. Add. Information: LocusID 1672

Application Details
Alternatives Secondary Antibodies Variants back to top

Application Notes ELISA. Western blot. Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Purification Purified
Buffer 50 mM TRIS pH 7,4Reconstitution: Restore in aqua bidest to 1 mg/ml.
Storage Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing. Shelf life: One year from despatch.
Restrictions For Research Use only

Alternatives
Application Details Secondary Antibodies Variants back to top

Alternatives for antigen "Defensin, beta 1 (DEFB1)", type "Antibodies"
Hosts Rabbit (63), Mouse (4)
Reactivities Human (51), Mouse (Murine) (25), Rat (Rattus) (24), Dog (Canine) (4), Cow (Bovine) (3), Pig (Porcine) (3), Horse (Equine) (2), Rabbit (2), Sheep (Ovine) (2), Guinea Pig (1)
Applications Flow Cytometry (FACS) (36), Immunofluorescence (IF) (36), Western Blotting (WB) (25), ELISA (18), Enzyme Immunoassay (EIA) (11), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (4), Immunoprecipitation (IP) (4), Immunoelectron Microscopy (IEM) (2), Radioimmunoassay (RIA) (2)
Conjugates Biotin (6), Alexa Flour 488 (2), Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy5.5 (2), PE,Cy7 (2), RBITC (2)
Epitopes AA 1-36 (4), AA 1-5 (4), AA 18-26 (4), AA 28-34 (4)