ETV4 antibody (N-Term)

Catalog No. ABIN3042379

Product Details anti-ETV4 Antibody

Target: ETV4 (Ets Variant 4 (ETV4))

Binding Specificity: AA 1-41, N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ETV4 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for ETS translocation variant 4(ETV4) detection. Tested with WB in Human,Rat.

Sequence: MERRMKAGYL DQQVPYTFSS KSPGNGSLRE ALIGPLGKLM D

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for ETS translocation variant 4(ETV4) detection. Tested with WB in Human,Rat.
Gene Name: ets variant 4
Protein Name: ETS translocation variant 4

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1-41aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD), different from the related mouse sequence by seven amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ETV4

Target: ETV4 (Ets Variant 4 (ETV4))

Alternative Name: ETV4 (ETV4 Products)

Synonyms: E1A-F antibody, E1AF antibody, PEA3 antibody, PEAS3 antibody, Pea3 antibody, AW414408 antibody, Pea-3 antibody, pea3 antibody, ETS variant 4 antibody, ets variant 4 antibody, ETV4 antibody, Etv4 antibody, etv4 antibody

Background: ETS translocation variant 4 (ETV4), also known as polyoma enhancer activator 3 (PEA3), or E1AF, is a member of the PEA3 subfamily of Ets transcription factors. It is mapped to 17q21.31. E1AF can activate the promoters of various matrix metalloproteinases, genes whose expression is associated with tumor cell invasion and metastasis, by 10 to 20 fold. Pea3 is detected in cells of epithelial and fibroblastic origin. It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene.

Synonyms: Adenovirus E1A enhancer binding protein antibody|Adenovirus E1A enhancer-binding protein antibody|E1A F antibody|E1A-F antibody|ETS translocation variant 4 antibody|ets variant gene 4 (E1A enhancer binding protein E1AF) antibody|ETV4 antibody|ETV4_HUMAN antibody| PEA3 antibody|PEA3 protein antibody|PEAS3 antibody|Polyomavirus enhancer activator 3 antibody|Polyomavirus enhancer activator 3 homolog antibody|Protein PEA3 antibody

Gene ID: 2118

UniProt: P43268