CRY1 antibody (N-Term)
-
- Target See all CRY1 Antibodies
- CRY1 (Cryptochrome 1 (Photolyase-Like) (CRY1))
-
Binding Specificity
- AA 153-189, N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRY1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Cryptochrome-1(CRY1) detection. Tested with WB in Human,Rat.
- Sequence
- FQTLISKMEP LEIPVETITS EVIEKCTTPL SDDHDEK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Cryptochrome-1(CRY1) detection. Tested with WB in Human,Rat.
Gene Name: cryptochrome circadian clock 1
Protein Name: Cryptochrome-1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Cryptochrome I (153-189aa FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product CRY1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CRY1 (Cryptochrome 1 (Photolyase-Like) (CRY1))
- Alternative Name
- CRY1 (CRY1 Products)
- Synonyms
- cry1-A antibody, CRY1 antibody, cry2 antibody, phll1 antibody, xCRY1 antibody, PHLL1 antibody, AU020726 antibody, AU021000 antibody, Phll1 antibody, ATCRY1 antibody, BLU1 antibody, BLUE LIGHT UNINHIBITED 1 antibody, CRYPTOCHROME 1 APOPROTEIN (BLUE LIGHT PHOTORECEPTOR antibody, ELONGATED HYPOCOTYL 4 antibody, HY4 antibody, OOP2 antibody, OUT OF PHASE 2 antibody, T3H13.14 antibody, T3H13_14 antibody, cryptochrome 1 antibody, cryptochrome circadian clock 1 L homeolog antibody, cryptochrome circadian regulator 1 antibody, cryptochrome circadian clock 1 antibody, Cryptochrome-1 antibody, cryptochrome 1 antibody, cryptochrome 1 (photolyase-like) antibody, cry1.L antibody, CRY1 antibody, cry1 antibody, siu50817b antibody, Cry1 antibody
- Background
-
This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And this gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness.
Synonyms: Cry1 antibody|CRY1_HUMAN antibody|Cryptochrome 1 (photolyase like) antibody|Cryptochrome 1 antibody|Cryptochrome-1 antibody|PHLL1 antibody|Photolyase 1 antibody|Photolyase-like antibody - Gene ID
- 1407
- UniProt
- Q16526
- Pathways
- Response to Water Deprivation, Proton Transport
-