KCNIP2 antibody (N-Term)

Catalog No. ABIN3043273

Product Details anti-KCNIP2 Antibody

Target: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Binding Specificity: AA 78-112, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNIP2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Kv channel-interacting protein 2(KCNIP2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: DEFELSTVCH RPEGLEQLQE QTKFTRKELQ VLYR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Kv channel-interacting protein 2(KCNIP2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: Kv channel interacting protein 2
Protein Name: Kv channel-interacting protein 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for KCNIP2

Target: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Alternative Name: KCNIP2 (KCNIP2 Products)

Synonyms: KCHIP2 antibody, KCNIP2 antibody, Kchip2 antibody, KChIP2 antibody, kchip2 antibody, si:ch73-173h19.2 antibody, potassium voltage-gated channel interacting protein 2 antibody, Kv channel-interacting protein 2 antibody, Kv channel interacting protein 2 S homeolog antibody, Kv channel interacting protein 2 antibody, KCNIP2 antibody, Kcnip2 antibody, kcnip2.S antibody, kcnip2 antibody

Background: Kv channel-interacting protein 2 also known as KChIP2 is a protein that in humans is encoded by the KCNIP2 gene. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. And they are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.

Synonyms: A type potassium channel modulatory protein 2 antibody|A-type potassium channel modulatory protein 2 antibody|Cardiac voltage gated potassium channel modulatory subunit antibody|Cardiac voltage-gated potassium channel modulatory subunit antibody|DKFZp566L1246 antibody|KChIP 2 antibody|KChIP2 antibody|KCIP2_HUMAN antibody|KCNIP 2 antibody|Kcnip2 antibody|Kv channel interacting protein 2 antibody|Kv channel-interacting protein 2 antibody|MGC17241 antibody|Potassium channel interacting protein 2 antibody|Potassium channel-interacting protein 2 antibody

Gene ID: 30819