RRM2 antibody (N-Term)

Catalog No. ABIN3043425

Product Details anti-RRM2 Antibody

Target: RRM2 (Ribonucleotide Reductase M2 (RRM2))

Binding Specificity: AA 1-33, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RRM2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Ribonucleoside-diphosphate reductase subunit M2(RRM2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: MLSLRVPLAP ITDPQQLQLS PLKGLSLVDK ENT

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Ribonucleoside-diphosphate reductase subunit M2(RRM2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ribonucleotide reductase M2
Protein Name: Ribonucleoside-diphosphate reductase subunit M2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human RRM2 (1-33aa MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT), different from the related mouse and rat sequences by eight amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-RRM2 antibody (ABIN3043425)

Xu, Li, Tao, Li, Fang, Zhao, Li, Li, Wang, Feng, Pan: "Histone acetyltransferase inhibitor II induces apoptosis in glioma cell lines via the p53 signaling pathway." in: Journal of experimental & clinical cancer research : CR, Vol. 33, pp. 108, (2015) (PubMed).

Target Details for RRM2

Target: RRM2 (Ribonucleotide Reductase M2 (RRM2))

Alternative Name: RRM2 (RRM2 Products)

Synonyms: R2 antibody, RR2 antibody, RR2M antibody, AA407299 antibody, rrm2 antibody, rr2m antibody, cb111 antibody, chunp6884 antibody, r2 antibody, ribonucleotide reductase regulatory subunit M2 antibody, ribonucleotide reductase M2 antibody, ribonucleotide reductase M2, gene 2 L homeolog antibody, ribonucleotide reductase M2, gene 1 antibody, ribonucleotide reductase M2 polypeptide antibody, RRM2 antibody, Rrm2 antibody, rrm2.2.L antibody, rrm2.1 antibody, rrm2 antibody

Background: Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene. It is mapped to 2p25-p24. This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.

Synonyms: R2 antibody|Ribonucleoside-diphosphate reductase subunit M2 antibody|Ribonucleotide reductase M2 antibody|Ribonucleotide reductase M2 polypeptide antibody|Ribonucleotide reductase M2 subunit antibody|Ribonucleotide reductase small chain antibody|Ribonucleotide reductase small subunit antibody|RIR2_HUMAN antibody|RR2 antibody|RR2M antibody|RRM2 antibody

Gene ID: 6241

UniProt: P31350

Pathways: Mitotic G1-G1/S Phases