Did you know that you can buy products from over 140 different suppliers from us?

Receptor-Interacting serine-threonine Kinase 3 (RIPK3) (N-Term) antibody

Details for Product No. ABIN309612
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RIP3, Hcyp2, 2610528K09Rik, AW107945, Rip3, RIPK3
Epitope
N-Term
(15), (12), (9), (7), (5), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Cow (Bovine), Human
(77), (31), (19), (14), (13), (12), (12), (3)
Host
Rabbit
(90), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(6), (6), (5), (4), (4), (4), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(80), (45), (34), (21), (10), (5), (3), (2), (1), (1)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN309612
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RIPK3
Sequence GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSF GILMWAVLAG
Predicted Reactivity Human : 100 %, Dog : 90 %, Horse : 80 %, Mouse : 80 %, Pig : 80 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against RIPK3. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name RIPK3
Background RIPK3 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.
Molecular Weight 57 kDa
Gene ID 11035
NCBI Accession NM_006871, NP_006862
UniProt Q9Y572
Research Area Apoptosis/Necrosis, Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 518 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Receptor-Interacting serine-threonine Kinase 3 (RIPK3) (N-Term) antibody WB Suggested Anti-RIPK3 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
anti-Receptor-Interacting serine-threonine Kinase 3 (RIPK3) (N-Term) antibody (2) anti-Receptor-Interacting serine-threonine Kinase 3 (RIPK3) (N-Term) antibody (Image 2)
anti-Receptor-Interacting serine-threonine Kinase 3 (RIPK3) (N-Term) antibody (3) anti-Receptor-Interacting serine-threonine Kinase 3 (RIPK3) (N-Term) antibody (Image 3)
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309612
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top