Mitochondrial Ribosomal Protein S15 (MRPS15) (N-Term) antibody

Details for Product No. ABIN309692
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms MPR-S15, RPMS15, S15mt, Mprs15, 1500003E24Rik, 2410002B11Rik, CG4207, DmMRPS15, Dmel\\CG4207, MRP-S15, mRpS15, zgc:92862
Epitope
N-Term
(3), (2), (2), (2), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Human
(13), (4), (4), (1)
Host
Rabbit
(13)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(12), (4), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN309692
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MRPS15
Sequence RGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVK RLLSLEMANK
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Human : 100 %, Dog : 90 %, Rabbit : 80 %, Mouse : 80 %
Characteristics This is a rabbit polyclonal antibody against MRPS15. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name MRPS15
Background Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS15 is a 28S subunit protein that belongs to the ribosomal protein S15P family.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75 % protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S15P family. The encoded protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the encoded protein is the least conserved among small subunit ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 15q and 19q.
Molecular Weight 30 kDa
Gene ID 64960
NCBI Accession NM_031280, NP_112570
UniProt P82914
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 257 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Mitochondrial Ribosomal Protein S15 (MRPS15) (N-Term) antibody WB Suggested Anti-MRPS15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 721_B cell lysate
anti-Mitochondrial Ribosomal Protein S15 (MRPS15) (N-Term) antibody (2) anti-Mitochondrial Ribosomal Protein S15 (MRPS15) (N-Term) antibody (Image 2)
Background publications Zhang, Gerstein: "Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome." in: Genomics, Vol. 81, Issue 5, pp. 468-80, 2003 (PubMed).

Hosts (13)
Reactivities (13), (4), (4), (1)
Applications (12), (4), (3), (3), (1)
Epitopes (3), (2), (2), (2), (1)
back to top