Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 239 (ZNF239) antibody

Antigen

Zinc Finger Protein 239 (ZNF239)

Synonyms ZNF239, DKFZp468C049
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN309789
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF239
Gene ID ZNF239
UniProt Q16600
Immunogen The immunogen for anti-ZNF239 antibody: synthetic peptide directed towards the middle region of human ZNF239
Sequence WKSQVVSCSQQRAHTEEKPCDHNNCGKILNTSPDGHPYEK IHTAEKQYEC
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF239 antibody concentration is 1 mg/ml.
Description MOK2 proteins are DNA- and RNA-binding proteins that are mainly associated with nuclear RNP components, including the nucleoli and extranucleolar structures.MOK2 proteins are DNA- and RNA-binding proteins that are mainly associated with nuclear RNP components, including the nucleoli and extranucleolar structures (Arranz et al., 1997).[supplied by OMIM].
Characteristics Antigen Size: 458 amino acids
Molecular Weight 52kDa

Application Details

Application Notes WB Suggested Anti-ZNF239 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Dreuillet, Tillit, Kress et al.: "In vivo and in vitro interaction between human transcription factor MOK2 and nuclear lamin A/C." in: Nucleic acids research, Vol. 30, Issue 21, pp. 4634-42, 2002 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 239 (ZNF239)", type "Antibodies"
Hosts Rabbit (25), Mouse (1)
Reactivities Human (26)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (11), ELISA (5), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (3), Internal Region (1)