Minichromosome Maintenance Complex Component 3 (MCM3) antibody

Antigen: Minichromosome Maintenance Complex Component 3 (MCM3)

Synonyms: HCC5, P1.h, RLFB, MGC1157, P1-MCM3, mcm3, MGC53530

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN309828

Additional Information

Alternative name: MCM3

Gene ID: MCM3

Immunogen: The immunogen for anti-MCM3 antibody: synthetic peptide directed towards the C terminal of human MCM3

Sequence: YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRK RRKTRQPDAK

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MCM3 antibody concentration is 1 mg/ml.

Description: MCM3 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 808 amino acids

Molecular Weight: 91kDa

Application Details

Application Notes: WB Suggested Anti-MCM3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate.
Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5µg/ml using anti-MCM3 antibody (ABIN309828).

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-MCM3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5µg/ml using anti-MCM3 antibody (ARP36644_P050)

Publications

Product: Lin, Aggarwal, Diehl: "Phosphorylation of MCM3 on Ser-112 regulates its incorporation into the MCM2-7 complex." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 23, pp. 8079-84, 2008 (PubMed).