Minichromosome Maintenance Complex Component 6 (MCM6) antibody

Antigen: Minichromosome Maintenance Complex Component 6 (MCM6)

Synonyms: Mis5, P105MCM, MCG40308, Mcmd6, ASP-l1, D1Wsu22e

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN309830

Additional Information

Alternative name: MCM6

Gene ID: MCM6

UniProt: Q14566

Immunogen: The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6

Sequence: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPY LVVNPNYLLE

Cross-Reactivity: Dog (Canine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MCM6 antibody concentration is 1 mg/ml.

Description: The protein encoded by the MCM6 gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.

Characteristics: Antigen Size: 821 amino acids

Molecular Weight: 90kDa

Application Details

Application Notes: WB Suggested Anti-MCM6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.
Immunohistochemistry with Thymus tissue at an antibody concentration of 5µg/ml using anti-MCM6 antibody (ABIN309830).

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-MCM6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Immunohistochemistry with Thymus tissue at an antibody concentration of 5µg/ml using anti-MCM6 antibody (ARP36650_P050)

Thymus

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).