BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4) (Middle Region) antibody

Details for Product No. ABIN309833
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AU017169, 2210017A09Rik, bA321C24.3, wu:fk37b10, zgc:92463
Epitope
Middle Region
(5), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(15), (4), (1), (1), (1), (1), (1)
Host
Rabbit
(13), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(18), (4), (2), (2), (1)
Pubmed 2 references available
Catalog no. ABIN309833
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human KCTD4
Sequence RSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSIS SNIIQFKYFI
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against KCTD4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KCTD4
Background KCTD4 contains 1 BTB (POZ) domain. The exact function of KCTD4 remains unknown.
Molecular Weight 30 kDa
Gene ID 386618
NCBI Accession NM_198404, NP_940686
UniProt Q8WVF5
Research Area Signaling, Metabolism, Transporters
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 259 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (13), (5)
Reactivities (15), (4), (1), (1), (1), (1), (1)
Applications (18), (4), (2), (2), (1)
Epitopes (5), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top