Myeloid/lymphoid Or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila); Translocated To, 3 (MLLT3) antibody

Antigen: Myeloid/lymphoid Or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila); Translocated To, 3 (MLLT3)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Zebrafish, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN309893

Additional Information

Alternative name: MLLT3 / AF9

Gene ID: MLLT3

UniProt: P42568

Immunogen: The immunogen for anti-MLLT3 antibody: synthetic peptide directed towards the N terminal of human MLLT3

Sequence: MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPE HSNIQHFVEK

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MLLT3 antibody concentration is 1 mg/ml.

Description: MLLT3 is a regulator of early erythroid and megakaryocytic cell fate in the human system. Expression of MLLT3 in human CD34+ cells induces acute myeloid, lymphoid, or mixed-lineage leukemia in immunodeficient mice. Translocation t (9,11)(p22,q23), a chromosomal aberration involving MLLT3 is associated with acute leukemias.

Characteristics: Antigen Size: 568 amino acids

Molecular Weight: 63kDa

Application Details

Application Notes: WB Suggested Anti-MLLT3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MLLT3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Wei, Wunderlich, Fox et al.: "Microenvironment determines lineage fate in a human model of MLL-AF9 leukemia." in: Cancer cell, Vol. 13, Issue 6, pp. 483-95, 2008 (PubMed).