Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309949

Death Inducer-Obliterator 1 (DIDO1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
BYE1, C20orf158, DATF-1, DATF1, DIDO2, DIDO3, DIO-1, DIO1, dJ885L7.8, Datf1, Dido2, Dido3, mKIAA0333, C530043I07, 6720461J16Rik, D130048F08Rik, datf1l, fi35b04, wu:fi35b04, zgc:158157, DIDO1, DKFZp469 ... show more
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309949
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DIDO1 antibody: synthetic peptide directed towards the C terminal of human DIDO1
Sequence KKAVVVPARSEALGKEAACESSTPSWASDHNYNAVKPEKT AAPSPSLLYK
Predicted Reactivity Chicken : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Dog : 92%, Horse : 92%, Guinea pig : 85%, African clawed frog : 84%, Zebrafish : 84%
Characteristics This is a rabbit polyclonal antibody against DIDO1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DIDO1
Background In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. DIDO1 gene is similar to the mouse gene and therefore is thought to be involved in apoptosis.Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms.Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms.
Molecular Weight 61kDa
Gene ID 11083
NCBI Accession NP_071388, NM_022105
UniProt Q9BTC0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DIDO1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Trachana, van Wely, Guerrero et al.: "Dido disruption leads to centrosome amplification and mitotic checkpoint defects compromising chromosome stability." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 104, Issue 8, pp. 2691-6, 2007 (PubMed).

Alternatives for antigen "Death Inducer-Obliterator 1 (DIDO1)", type "Antibodies"
Hosts (32), (7)
Reactivities (38), (24), (15), (2), (2), (1)
Applications (29), (14), (9), (4), (3), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (3), (1), (1)
Beacon