Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309984

Zinc Finger Protein 57 (ZFP57) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF424, G19, Zfp-57
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309984
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF57 antibody: synthetic peptide directed towards the N terminal of human ZNF57
Sequence MDSVVFEDVAVDFTLEEWALLDSAQRDLYRDVMLETFRNL ASVDDGTQFK
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF57. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZNF57
Background The function of ZNF57 remains unkonwn.
Molecular Weight 64kDa
Gene ID 126295
NCBI Accession NP_775751, NM_173480
UniProt Q68EA5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF57 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lichter, Bray, Ried et al.: "Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes." in: Genomics, Vol. 13, Issue 4, pp. 999-1007, 1992 (PubMed).

Alternatives for antigen "Zinc Finger Protein 57 (ZFP57)", type "Antibodies"
Hosts (8), (1)
Reactivities (9), (1)
Applications (9), (1), (1), (1)
Epitopes (6), (2), (2), (1), (1)
Beacon