Zinc Finger Protein 57 (ZFP57) (N-Term) antibody

Details for Product No. ABIN309984
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ZNF424, G19, Zfp-57
Epitope
N-Term
(3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(8), (1)
Host
Rabbit
(7), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN309984
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF57
Sequence MDSVVFEDVAVDFTLEEWALLDSAQRDLYRDVMLETFRNL ASVDDGTQFK
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF57. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ZNF57
Background The function of ZNF57 remains unkonwn.
Molecular Weight 64 kDa
Gene ID 126295
NCBI Accession NM_173480, NP_775751
UniProt Q68EA5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 555 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 57 (ZFP57) (N-Term) antibody WB Suggested Anti-ZNF57 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
Background publications Lichter, Bray, Ried et al.: "Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes." in: Genomics, Vol. 13, Issue 4, pp. 999-1007, 1992 (PubMed).

Hosts (7), (1)
Reactivities (8), (1)
Applications (8), (1), (1), (1)
Epitopes (3), (2), (1), (1)
back to top