JAZF Zinc Finger 1 (JAZF1) antibody

Antigen: JAZF Zinc Finger 1 (JAZF1)

Synonyms: TIP27, ZNF802, DKFZp761K2222, JAZF1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN309985

Additional Information

Alternative name: JAZF1 / ZNF802

Gene ID: JAZF1

UniProt: Q86VZ6

Immunogen: The immunogen for anti-JAZF1 antibody: synthetic peptide directed towards the C terminal of human JAZF1

Sequence: KKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQ GLRHHTINFH

Cross-Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-JAZF1 antibody concentration is 1 mg/ml.

Description: JAZF1 is a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors.This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.

Characteristics: Antigen Size: 243 amino acids

Molecular Weight: 27kDa

Application Details

Application Notes: WB Suggested Anti-JAZF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-JAZF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

anti-JAZF Zinc Finger 1 (JAZF1) antibody (Image 2)

Publications

Ahn, Berndt, Wacholder et al.: "Variation in KLK genes, prostate-specific antigen and risk of prostate cancer." in: Nature genetics, Vol. 40, Issue 9, pp. 1032-4; author reply 1035-6, 2009 (PubMed).

Product: Thomas, Jacobs, Yeager et al.: "Multiple loci identified in a genome-wide association study of prostate cancer." in: Nature genetics, Vol. 40, Issue 3, pp. 310-5, 2008 (PubMed).