Tubulin, beta 2A (TUBB2A) antibody

Antigen: Tubulin, beta 2A (TUBB2A)

Synonyms: TUBB, TUBB2, dJ40E16.7, Tubb2, M(beta)2, TUBB2A, tubb5, beta-5, tubb2a, MGC69524, TUBB2C, MGC128183, TUBB5, MGC128415, DKFZp459E2213, MC1R, TUBB4, beta-4, TUBB3, MGC134115, tbb3

Clonality: Polyclonal

Host: Rabbit

Reactivity: Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus), Arabidopsis

Application: Western Blotting (WB)

Catalog no.: ABIN309995

Additional Information

Alternative name: TUBB2A

Gene ID: TUBB2A

UniProt: Q13885

Immunogen: The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the middle region of human TUBB2A

Sequence: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM FDSKNMMAAC

Cross-Reactivity: Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TUBB2A antibody concentration is 1 mg/ml.

Description: TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Characteristics: Antigen Size: 445 amino acids

Molecular Weight: 49kDa

Application Details

Application Notes: WB Suggested Anti-TUBB2A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Cytoskeleton

Restrictions: For Research Use only

Images

WB Suggested Anti-TUBB2A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Frum, Busby, Ramamoorthy et al.: "HDM2-binding partners: interaction with translation elongation factor EF1alpha." in: Journal of proteome research, Vol. 6, Issue 4, pp. 1410-7, 2007 (PubMed).