Ribosomal Protein L13 (RPL13) antibody

Antigen: Ribosomal Protein L13 (RPL13)

Synonyms: BBC1, D16S444E, FLJ27453, FLJ27454, MGC71373, MGC117342

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Dog (Canine), Rat (Rattus), Xenopus laevis, Pig (Porcine), Zebrafish, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN310002

Additional Information

Alternative name: RPL13 / BBC1

Gene ID: RPL13

UniProt: P26373

Immunogen: The immunogen for anti-RPL13 antibody: synthetic peptide directed towards the C terminal of human RPL13

Sequence: KGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKN FKAFASLRMA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-RPL13 antibody concentration is 1 mg/ml.

Description: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL13 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas. Transcript variants derived from alternative splicing and/or alternative polyadenylation exist, these variants encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas. Transcript variants derived from alternative splicing and/or alternative polyadenylation exist, these variants encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Characteristics: Antigen Size: 211 amino acids

Molecular Weight: 23kDa

Application Details

Application Notes: WB Suggested Anti-RPL13 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RPL13 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Bi, Yan, Stankiewicz et al.: "Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse." in: Genome research, Vol. 12, Issue 5, pp. 713-28, 2002 (PubMed).