Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ribosomal Protein L13 (RPL13) antibody

Antigen

Ribosomal Protein L13 (RPL13)

Synonyms BBC1, D16S444E, FLJ27453, FLJ27454, MGC71373, MGC117342
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Dog (Canine), Rat (Rattus), Xenopus laevis, Pig (Porcine), Zebrafish, Chicken

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN310002
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name RPL13 / BBC1
Gene ID RPL13
UniProt P26373
Immunogen The immunogen for anti-RPL13 antibody: synthetic peptide directed towards the C terminal of human RPL13
Sequence KGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKN FKAFASLRMA
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-RPL13 antibody concentration is 1 mg/ml.
Description Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL13 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas. Transcript variants derived from alternative splicing and/or alternative polyadenylation exist, these variants encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas. Transcript variants derived from alternative splicing and/or alternative polyadenylation exist, these variants encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Characteristics Antigen Size: 211 amino acids
Molecular Weight 23kDa

Application Details

Application Notes WB Suggested Anti-RPL13 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Bi, Yan, Stankiewicz et al.: "Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse." in: Genome research, Vol. 12, Issue 5, pp. 713-28, 2002 (PubMed).

Alternatives

Alternatives for antigen "Ribosomal Protein L13 (RPL13)", type "Antibodies"
Hosts Rabbit (13), Mouse (1)
Reactivities Human (11), Mouse (Murine) (4), Rat (Rattus) (4), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1), Pig (Porcine) (1), Xenopus laevis (1), Zebrafish (1)
Applications Western Blotting (WB) (13), ELISA (6), Immunohistochemistry (IHC) (5), Immunocytochemistry (ICC) (1), Immunofluorescence (IF) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)
Epitopes C-Term (2)