Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) antibody

Antigen: Splicing Factor 3b, Subunit 1, 155kDa (SF3B1)

Synonyms: PRP10, PRPF10, SAP155, SF3b155, TA-8, Prp10, Targ4, 155kDa, AA409119, 2810001M05Rik, prp10, hsh155, prpf10, sap155, MGC115390, SF3B1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Chicken, Zebrafish, Fruit Fly (Drosophila melanogaster)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310007

Additional Information

Alternative name: SF3B1 / SAP155

Gene ID: SF3B1

UniProt: O75533

Immunogen: The immunogen for anti-SF3B1 antibody: synthetic peptide directed towards the N terminal of human SF3B1

Sequence: MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYD QEIYGGSDSR

Cross-Reactivity: Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-SF3B1 antibody concentration is 1 mg/ml.

Description: SF3B1 is subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures.This gene encodes subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures. Alternative splicing results in multiple transcript variants encoding different isoforms.

Characteristics: Antigen Size: 1304 amino acids

Molecular Weight: 143kDa

Application Details

Application Notes: WB Suggested Anti-SF3B1 Antibody Titration: 1.25ug/ml
Positive Control: Human Thymus.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SF3B1 Antibody Titration: 1.25ug/ml
Positive Control: Human Thymus

anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) antibody (Image 2)

anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) antibody (Image 3)

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).