RNA Binding Protein with Multiple Splicing (RBPMS) antibody

Antigen: RNA Binding Protein with Multiple Splicing (RBPMS)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish, Chicken

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)

Catalog no.: ABIN310013

Additional Information

Alternative name: RBPMS / HERMES

Gene ID: RBPMS

UniProt: Q569H2

Immunogen: The immunogen for anti-RBPMS antibody: synthetic peptide directed towards the N terminal of human RBPMS

Sequence: LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALN GIRFDPEIPQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-RBPMS antibody concentration is 1 mg/ml.

Description: RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.This gene encodes a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. The protein encoded by this gene has a single, putative RRM domain in its N-terminus. Alternative splicing results in multiple transcript variants encoding different isoforms.

Characteristics: Antigen Size: 219 amino acids

Molecular Weight: 24kDa

Application Details

Application Notes: WB Suggested Anti-RBPMS Antibody Titration: 0.5ug/ml
Positive Control: Human Liver.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RBPMS Antibody Titration: 0.5ug/ml
Positive Control: Human Liver

anti-RNA Binding Protein with Multiple Splicing (RBPMS) antibody (Image 2)

anti-RNA Binding Protein with Multiple Splicing (RBPMS) antibody (Image 3)

Publications

Product: Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).