RBPMS antibody (N-Term)

Catalog No. ABIN630003

Product Details anti-RBPMS Antibody

Target: RBPMS (RNA Binding Protein with Multiple Splicing (RBPMS))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBPMS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RBPMS antibody was raised against the N terminal of RBPMS

Purification: Purified

Immunogen: RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBPMS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBPMS

Target: RBPMS (RNA Binding Protein with Multiple Splicing (RBPMS))

Alternative Name: RBPMS (RBPMS Products)

Synonyms: HERMES antibody, 2010300K22Rik antibody, 2700019M19Rik antibody, AU017537 antibody, hermes antibody, RGD1561067 antibody, si:cabz01079824.1 antibody, RNA binding protein with multiple splicing antibody, RNA binding protein gene with multiple splicing antibody, RNA binding protein with multiple splicing L homeolog antibody, RBPMS antibody, Rbpms antibody, rbpms.L antibody, rbpms antibody

Background: RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.

Molecular Weight: 24 kDa (MW of target protein)