Splicing Factor, Suppressor of White-Apricot Homolog (Drosophila) (SFSWAP) antibody

Antigen: Splicing Factor, Suppressor of White-Apricot Homolog (Drosophila) (SFSWAP)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN310048

Additional Information

Alternative name: SFRS8 / SWAP

Gene ID: SFRS8

UniProt: Q12872

Immunogen: The immunogen for anti-SFRS8 antibody: synthetic peptide directed towards the N terminal of human SFRS8

Sequence: MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGY ACKLFRDDER

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-SFRS8 antibody concentration is 1 mg/ml.

Description: SFRS8 is a human homolog of Drosophila splicing regulatory protein.This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Multiple alternatively spliced variants have been identified. Two alternatively spliced variants have been characterized to date.

Characteristics: Antigen Size: 951 amino acids

Molecular Weight: 105kDa

Application Details

Application Notes: WB Suggested Anti-SFRS8 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SFRS8 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).