Poly(A) Binding Protein Interacting Protein 1 (PAIP1) antibody

Antigen: Poly(A) Binding Protein Interacting Protein 1 (PAIP1)

Synonyms: fb53g01, zgc:91954, wu:fb53g01, PAIP1, MGC160051, MGC12360

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN310064

Additional Information

Alternative name: PAIP1

Gene ID: PAIP1

UniProt: Q9H074-2

Immunogen: The immunogen for anti-PAIP1 antibody: synthetic peptide directed towards the N terminal of human PAIP1

Sequence: MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVV VAPVLMSKLS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PAIP1 antibody concentration is 1 mg/ml.

Description: PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.

Characteristics: Antigen Size: 400 amino acids

Molecular Weight: 46kDa

Application Details

Application Notes: WB Suggested Anti-PAIP1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-PAIP1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart

Publications

Product: Fortna, Kim, MacLaren et al.: "Lineage-specific gene duplication and loss in human and great ape evolution." in: PLoS biology, Vol. 2, Issue 7, pp. E207, 2004 (PubMed).