CTA-126B4.3 (N-Term) antibody

Details for Product No. ABIN310081
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
N-Term
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Catalog no. ABIN310081
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CTA-126B4.3
Sequence NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESR SKFFHPKPVP
Predicted Reactivity Rat :100 %,   Crab-eating macaque :100 %,   Human :100 % Sumatran orangutan :90 %,   Bovine :90 %,   Mouse :90 %,   Dog :80 %,  
Characteristics This is a rabbit polyclonal antibody against CTA-126B4.3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Background The exact function of CTA-126B4.3 remains unknown.
Molecular Weight 32 kDa
Gene ID 27341
NCBI Accession NM_015703, NP_056518
UniProt Q9Y3A4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 280 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-CTA-126B4.3 (N-Term) antibody WB Suggested Anti-CTA-126B4.3 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
Background publications Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).

Hosts (1)
Applications (1)
back to top