Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310081

CTA-126B4.3 (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310081
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CTA-126B4.3 antibody: synthetic peptide directed towards the N terminal of human CTA-126B4.3
Sequence NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESR SKFFHPKPVP
Predicted Reactivity Rat :100%,   Crab-eating macaque :100%,   Human :100% Sumatran orangutan :92%,   Bovine :91%,   Mouse :91%,   Dog :83%,  
Characteristics This is a rabbit polyclonal antibody against CTA-126B4.3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background The exact function of CTA-126B4.3 remains unknown.
Molecular Weight 32kDa
Gene ID 27341
NCBI Accession NP_056518, NM_015703
UniProt Q9Y3A4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CTA-126B4.3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).

Alternatives for antigen "CTA-126B4.3", type "Antibodies"
Hosts (1)
Applications (1)
Beacon