Did you know that you can buy products from over 140 different suppliers from us?

CTA-126B4.3 (N-Term) antibody

Details for Product No. ABIN310081
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310081
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CTA-126B4.3
Sequence NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESR SKFFHPKPVP
Predicted Reactivity Rat :100 %,   Crab-eating macaque :100 %,   Human :100 % Sumatran orangutan :90 %,   Bovine :90 %,   Mouse :90 %,   Dog :80 %,  
Characteristics This is a rabbit polyclonal antibody against CTA-126B4.3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Background The exact function of CTA-126B4.3 remains unknown.
Molecular Weight 32 kDa
Gene ID 27341
NCBI Accession NM_015703, NP_056518
UniProt Q9Y3A4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 280 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-CTA-126B4.3 (N-Term) antibody WB Suggested Anti-CTA-126B4.3 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
Background publications Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).

Hosts (1)
Applications (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310081
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top