Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2) antibody

Antigen: Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2)

Synonyms: Cpsf, MCPSF, 100kDa, AI662483, mKIAA1367, 2610024B04Rik, CPSF100, KIAA1367, cpsf2-A, zgc:92484

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish, Chicken, Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN310084

Additional Information

Alternative name: CPSF2

Gene ID: CPSF2

UniProt: Q9P2I0

Immunogen: The immunogen for anti-CPSF2 antibody: synthetic peptide directed towards the N terminal of human CPSF2

Sequence: YAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFT LFTLDDVDAA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CPSF2 antibody concentration is 1 mg/ml.

Description: CPSF2 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. It belongs to the metallo-beta-lactamase superfamily, RNA-metabolizing metallo-beta-lactamase-like family, CPSF2/YSH1 subfamily.

Characteristics: Antigen Size: 782 amino acids

Molecular Weight: 88kDa

Application Details

Application Notes: WB Suggested Anti-CPSF2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-CPSF2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).