Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310102

Chromosome 7 Open Reading Frame 64 (C7orf64) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C7orf64, DKFZP564O0523, HSPC304, RGD1310794, C4H7orf64, AW548102, C030048B08Rik
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310102
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DKFZP564O0523 antibody: synthetic peptide directed towards the C terminal of human DKFZP564O0523
Sequence FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHK LKEVISSVPK
Predicted Reactivity Sumatran orangutan :100%,   Human :100%,   Rat :92%,   Mouse :85%,   Chicken :78%,  
Characteristics This is a rabbit polyclonal antibody against DKFZP564O0523. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DKFZP564O0523
Background The exact functions of DKFZP564O0523 remain unknown.
Molecular Weight 42kDa
Gene ID 84060
NCBI Accession NP_115496, NM_032120
UniProt Q5RL73
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DKFZP564O0523 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives for antigen "Chromosome 7 Open Reading Frame 64 (C7orf64)", type "Antibodies"
Hosts (18)
Reactivities (16), (14), (12), (12), (12), (12)
Applications (10), (9), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1), (1)
Beacon