Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 7 Open Reading Frame 64 (C7orf64) (C-Term) antibody

Details for Product No. ABIN310102
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C7orf64, DKFZP564O0523, HSPC304, RGD1310794, AW548102, C030048B08Rik, dkfzp564o0523, C4H7orf64
Epitope
C-Term
(8), (6), (2), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Human, Chicken
(22), (14), (12), (12), (12), (12)
Host
Rabbit
(24)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (10), (7), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310102
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human DKFZP564O0523
Sequence FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHK LKEVISSVPK
Predicted Reactivity Sumatran orangutan :100 %,   Human :100 %,   Rat :90 %,   Mouse :80 %,   Chicken :70 %,  
Characteristics This is a rabbit polyclonal antibody against DKFZP564O0523. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DKFZP564O0523
Background The exact functions of DKFZP564O0523 remain unknown.
Molecular Weight 42 kDa
Gene ID 84060
NCBI Accession NM_032120, NP_115496
UniProt Q5RL73
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 367 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 7 Open Reading Frame 64 (C7orf64) (C-Term) antibody WB Suggested Anti-DKFZP564O0523 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Validation Images
back to top