Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310124

NOP2/Sun Domain Family, Member 6 (NSUN6) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933414E04Rik, NOPD1, 4933403D21Rik, Nopd1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310124
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NSUN6 antibody: synthetic peptide directed towards the N terminal of human NSUN6
Sequence MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFE TLLKHLSHPP
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Horse : 92%, Pig : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against NSUN6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NSUN6
Background NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Molecular Weight 52kDa
Gene ID 221078
NCBI Accession NP_872349, NM_182543
UniProt Q8TEA1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NSUN6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives for antigen "NOP2/Sun Domain Family, Member 6 (NSUN6)", type "Antibodies"
Hosts (8)
Reactivities (6), (1), (1), (1)
Applications (8), (2), (2), (1)
Epitopes (3), (1)
Beacon