Cytochrome P450, Family 2, Subfamily E, Polypeptide 1 (CYP2E1) antibody

Antigen: Cytochrome P450, Family 2, Subfamily E, Polypeptide 1 (CYP2E1)

Synonyms: CPE1, CYP2E, P450-J, P450C2E, Cyp2e, CYP2E1, CYPIIE1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Rabbit, Pig (Porcine), Dog (Canine), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310147

Additional Information

Alternative name: CYP2E1

Gene ID: CYP2E1

UniProt: P05181

Immunogen: The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1

Sequence: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGE GLARMELFLL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CYP2E1 antibody concentration is 1 mg/ml.

Description: CYP2E1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.

Characteristics: Antigen Size: 493 amino acids

Molecular Weight: 54kDa

Application Details

Application Notes: WB Suggested Anti-CYP2E1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CYP2E1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Publications

Product: Dey, Kessova, Cederbaum: "Decreased protein and mRNA expression of ER stress proteins GRP78 and GRP94 in HepG2 cells over-expressing CYP2E1." in: Archives of biochemistry and biophysics, Vol. 447, Issue 2, pp. 155-66, 2006 (PubMed).